PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P14100_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 756aa    MW: 83188.6 Da    PI: 6.7854
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P14100_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.2e-2084139156
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            +++ +++t+ q++e+e++F+++++p++++r +L+++lgL+ rqVk+WFqNrR+++k
  GSMUA_Achr5P14100_001  84 KKRYHRHTARQIQEMEAMFKECPHPDEKQRMKLSHELGLKPRQVKFWFQNRRTQMK 139
                            688899***********************************************998 PP

2START130.52e-412614826206
                            HHHHHHHHHHHC-TT-EEEE.........EXCCTTEEEEEEESSS..............SCEEEEEEEECCSCHHHHHHHHHCCCGGC CS
                  START   6 aaqelvkkalaeepgWvkss.........esengdevlqkfeeskv.............dsgealrasgvvdmvlallveellddkeq 71 
                            aa+ lv++   +ep+W +           e++ +                         +++e++r+s++v+m+  + v  +ld + +
  GSMUA_Achr5P14100_001 261 AADHLVRMCNTNEPLWIRRGgstvevlnlEEHAR-----------McpwpmdlkqqqgrFRTETSRDSAMVIMNGITMVDAFLDAN-K 336
                            5666666666666666665533333322222222...........1222223333335679*************************.* PP

                            T-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EE CS
                  START  72 Wdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRael 147
                            W e ++    k  t++v+s+g      g l+lm aelq+lsplvp R+  f Ry++q +++g+w+ivd  vd  ++   +s++   ++
  GSMUA_Achr5P14100_001 337 WMELFPslvaKSRTVQVLSPGvpghgnGCLHLMHAELQFLSPLVPaREAHFFRYCQQnSEEGTWIIVDFPVDGFRDGI-QSPFPWYRR 423
                            ******9*99******************************************************************98.89999999* PP

                            SSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                  START 148 lpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                            ++Sg++i++++ng+skv+wveh++++++ +h++++++v+ g a+ga +wv+ lqrqce+
  GSMUA_Achr5P14100_001 424 RTSGCVIQDMPNGYSKVIWVEHAEVEDKPVHQIFQQFVSAGEAFGATRWVSVLQRQCER 482
                            *********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.51E-2070142IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-2279146IPR009057Homeodomain-like
PROSITE profilePS5007117.23281141IPR001356Homeobox domain
SMARTSM003895.1E-1982145IPR001356Homeobox domain
PfamPF000464.0E-1884139IPR001356Homeobox domain
CDDcd000864.87E-1984142No hitNo description
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PROSITE profilePS5084839.06247485IPR002913START domain
SuperFamilySSF559611.51E-26250484No hitNo description
CDDcd088751.38E-104251481No hitNo description
SMARTSM002347.5E-23256482IPR002913START domain
PfamPF018523.8E-34305482IPR002913START domain
SuperFamilySSF559612.47E-17500735No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
MYGDCQVLSS MVGGNVVSPD SLFSSSIQNP SLSFMANMPP FHAFSSIIPK EEGMMLMGRG  60
GSKEEEMESR SGSGPLDGQT AAKKKRYHRH TARQIQEMEA MFKECPHPDE KQRMKLSHEL  120
GLKPRQVKFW FQNRRTQMKA QQDRADNVVL RAENESLKND NFRLQAAIRN VVCPSCGGPA  180
ILGEMSFDEQ QLRIENARLK DERLSCIASR YSGRQHFHEP PVVSCTDLIP IPQISDEPSP  240
FPGMLIMDQD RPLVLDLAMT AADHLVRMCN TNEPLWIRRG GSTVEVLNLE EHARMCPWPM  300
DLKQQQGRFR TETSRDSAMV IMNGITMVDA FLDANKWMEL FPSLVAKSRT VQVLSPGVPG  360
HGNGCLHLMH AELQFLSPLV PAREAHFFRY CQQNSEEGTW IIVDFPVDGF RDGIQSPFPW  420
YRRRTSGCVI QDMPNGYSKV IWVEHAEVED KPVHQIFQQF VSAGEAFGAT RWVSVLQRQC  480
ERLASLMARN ISDNGVISSP EARKNMMRLS QRMITTFCTG VYASGMQSWT ALSDSSDDTV  540
RVTTKKNTAP GQPNGVILTA VSTTWLPSSH HQVFELLTDE QRRSQLDVLS SGNSLHEVAH  600
IANGSHPRNC ISLLRVNAAS NSSHSVDLLL QESSTHPSGG SIVVYAAIDV DAVQVAMSSE  660
DPSYIPLLPT GFVISPAARQ PNAGTGSGSD GHATVGCLLT VGMQVLATAV PSAKLNLSTV  720
TAINNHLCNT VQQVRAVIAG AGGTAMAEPA AVAPDQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009400958.10.0PREDICTED: homeobox-leucine zipper protein ROC3-like
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLM0SYD90.0M0SYD9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P14100_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78463441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7